PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00028957-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 294aa    MW: 33381.7 Da    PI: 6.8914
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00028957-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-072432762154
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            k +yp+++++++L +k+gL+ +q+ +WF N+R +
  SMil_00028957-RA_Salv 243 KWPYPTEDDKAKLVEKTGLQLKQINNWFINQRKR 276
                            469*****************************87 PP

2ELK25.53.1e-09197218122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK +L++++++++ ++++E++
  SMil_00028957-RA_Salv 197 ELKIELKQGFKSRIEDVREEIL 218
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.9E-193175IPR005540KNOX1
PfamPF037901.0E-173374IPR005540KNOX1
SMARTSM012565.8E-2486141IPR005541KNOX2
PfamPF037915.5E-1990140IPR005541KNOX2
PROSITE profilePS512139.132197217IPR005539ELK domain
PROSITE profilePS5007111.596217280IPR001356Homeobox domain
SuperFamilySSF466894.28E-16219284IPR009057Homeodomain-like
SMARTSM003891.9E-10219284IPR001356Homeobox domain
CDDcd000861.84E-11220281No hitNo description
Gene3DG3DSA:1.10.10.608.2E-25224283IPR009057Homeodomain-like
PfamPF059201.8E-17237276IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MQEQGMGMMG SGQIGGMNDV SMAAAPAEVH HQLKAEIATH PLYEQLLSAH VACLRVATPI  60
DQLPLIDAQL SQSHHILRSY AQNHAQSFSH HERQELDNFL AQYLLVLCSF REQLQQHVRV  120
HAVEAVMACR EIEQNLQSLT GAALGEGSGA TMSDDEDELQ MDFSLDQSGG DGHDLMGFGP  180
LLPTESERTL MERVRQELKI ELKQGFKSRI EDVREEILRK RRAGKLPGDT TTVLKNWWQQ  240
HSKWPYPTED DKAKLVEKTG LQLKQINNWF INQRKRNWHS NSQSATSLKS KRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12220276864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273293RKRNWHSNSQSATSLKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072032.10.0PREDICTED: homeobox protein HD1
SwissprotQ9FPQ81e-174KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLM5WA760.0M5WA76_PRUPE; KNOPE7
STRINGPGSC0003DMT4000585281e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67732329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-170KNOTTED-like homeobox of Arabidopsis thaliana 7